Prohibitin 2 antibody
70R-2417
50 µg
475 EUR
WB
Rabbit
1 mg/ml
Blue Ice
anticorps
Cell Biology
WB: 0.5 ug/ml
Human,Mouse,Rat
Primary Antibody
Affinity purified
Polyclonal Antibodies, Purified
Prohibitin 2 antibody was raised against the C terminal of PHB2
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHB2 antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Prohibitin 2 antibodies were raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Prohibitin 2 Blocking Peptide, catalog no. 33R-4533, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody
This is a rabbit polyclonal antibody against PHB2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com