Prohibitin 2 antibody

Prohibitin 2 antibody

Name

Prohibitin 2 antibody

Catalog number

70R-2417

Size

50 µg

Price

475 EUR

Tested for

WB

Raised in

Rabbit

Concentration

1 mg/ml

Shipping conditions

Blue Ice

French translation

anticorps

Area of research

Cell Biology

Usage Recommendations

WB: 0.5 ug/ml

Cross Reactivity

Human,Mouse,Rat

Category

Primary Antibody

Method of Purification

Affinity purified

Antibody Subtype

Polyclonal Antibodies, Purified

Specificity

Prohibitin 2 antibody was raised against the C terminal of PHB2

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHB2 antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Type of Immunogen

Prohibitin 2 antibodies were raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Assay Information

Prohibitin 2 Blocking Peptide, catalog no. 33R-4533, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody

Additional Information

This is a rabbit polyclonal antibody against PHB2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com