Prohibitin 2 antibody

Prohibitin 2 antibody


Prohibitin 2 antibody

Catalog number



50 µg


475 EUR

Tested for


Raised in



1 mg/ml

Shipping conditions

Blue Ice

French translation


Usage Recommendations

WB: 1 ug/ml

Area of research

Cell Biology

Cross Reactivity



Primary Antibody

Method of Purification

Affinity purified

Antibody Subtype

Polyclonal Antibodies, Purified


Prohibitin 2 antibody was raised against the N terminal of PHB2

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHB2 antibody in PBS


Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.


If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Type of Immunogen

Prohibitin 2 antibodies were raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR

Assay Information

Prohibitin 2 Blocking Peptide, catalog no. 33R-9946, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody

Additional Information

This is a rabbit polyclonal antibody against PHB2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at