Prohibitin 2 Blocking Peptide
33R-9946
100 µg
210 EUR
WB; IHC
Blue Ice
Proteins
Synthetic
Cell Biology
blocking peptide
Blocking Peptides
WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
You can block the antibody by the specific target amino acid sequence of peptide.
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.