Rabbit Prohibitin 2 antibody
70R-2417
50 ug
495 EUR
NA
WB
1 mg/ml
Blue Ice
anticorps
Cell Biology
Human,Mouse,Rat
Primary Antibodies
Oryctolagus cuniculus
Purified Polyclonal Antibodies
Prohibitin 2 antibody was raised against the C terminal of PHB2
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHB2 antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.